PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G12020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YB
Protein Properties Length: 266aa    MW: 30212.8 Da    PI: 5.1358
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G12020.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB721e-221195387
            NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87
                     ++d  lP + + +i+k++lP + ++++da++++ ec +efi +++se+++ c re++kti+++ +l al +lGf +y+e++++  
  OPUNC08G12020.1 11 KEDVSLPKSTMFKIIKEMLPPDVRVARDAQDLLVECCVEFINLLSSESNEVCSREDKKTIAPEHVLRALQDLGFREYIEEVQAAY 95
                     67999**************************************************************************998654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.1E-388140IPR009072Histone-fold
SuperFamilySSF471131.24E-3312140IPR009072Histone-fold
PfamPF008082.2E-191579IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MDPMDIVGKS KEDVSLPKST MFKIIKEMLP PDVRVARDAQ DLLVECCVEF INLLSSESNE  60
VCSREDKKTI APEHVLRALQ DLGFREYIEE VQAAYEHHKH DTLDSPKASK FTGVEMTEEQ  120
AVAEQQRMFA EARARMNNGA AKPKEPEPEA QQQTQQPLQP QLHPQPQQPL QPQLQLHPQP  180
QQQPSQLHPQ QQLLHPQSQQ TPQPQPQVHP QPQQPSQLQP QPQLPPQPQQ PPQLQPQPQL  240
HQQPPLQQAE LQSQSQPQTD HGLDSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B6e-331213312133Transcription Regulator NC2 beta chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4649020.0AF464902.1 Oryza sativa repressor protein (Dr1) mRNA, complete cds.
GenBankCT8301300.0CT830130.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA058B22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235094.11e-110PREDICTED: nuclear transcription factor Y subunit beta-like
SwissprotP495925e-81NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A0E0LUH60.0A0A0E0LUH6_ORYPU; Uncharacterized protein
STRINGBRADI3G34930.11e-109(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57203549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.49e-81nuclear factor Y, subunit B13